PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31887.2.p
Common NameBRADI_2g31887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 894aa    MW: 99056.4 Da    PI: 5.6595
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31887.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-185096148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd++l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
  Bradi2g31887.2.p 50 KGNWTLEEDDILRKAVQTYNGKNWKKIAECFR-DRTDVQCLHRWQKVL 96
                      79******************************.************986 PP

2Myb_DNA-binding60.63.3e-19102148148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W++eEd+++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Bradi2g31887.2.p 102 KGPWSKEEDDIIIEMVNEHGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                       79******************************.*************97 PP

3Myb_DNA-binding54.52.7e-17154196145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       r++WT+eE+ +l++a++ +G++ W+  +++++ gRt++ +k++w+
  Bradi2g31887.2.p 154 RDAWTQEEEIRLIQAHQAYGNK-WAELSKYLP-GRTDNAIKNHWH 196
                       789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1434596IPR017930Myb domain
SuperFamilySSF466896.76E-1848110IPR009057Homeodomain-like
SMARTSM007173.9E-164998IPR001005SANT/Myb domain
PfamPF002492.0E-155096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2352113IPR009057Homeodomain-like
CDDcd001677.23E-145296No hitNo description
PROSITE profilePS5129431.8597152IPR017930Myb domain
SuperFamilySSF466891.4E-3199195IPR009057Homeodomain-like
SMARTSM007173.0E-18101150IPR001005SANT/Myb domain
CDDcd001671.10E-15104148No hitNo description
PfamPF139213.2E-18105165No hitNo description
Gene3DG3DSA:1.10.10.608.6E-27114155IPR009057Homeodomain-like
SMARTSM007171.0E-15153201IPR001005SANT/Myb domain
PROSITE profilePS5129419.975153203IPR017930Myb domain
CDDcd001671.15E-11156196No hitNo description
Gene3DG3DSA:1.10.10.604.3E-22156202IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
MTSDKGRTTK KPAEVSASAL PPSDEEASSA VQKRRLPNGR KTGPARRSTK GNWTLEEDDI  60
LRKAVQTYNG KNWKKIAECF RDRTDVQCLH RWQKVLNPEL VKGPWSKEED DIIIEMVNEH  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINRDAWTQE EEIRLIQAHQ AYGNKWAELS  180
KYLPGRTDNA IKNHWHSSVK KKFESYRAEG LLAQLKGLPP VVYPTSLTVD SSSAMIQQNS  240
EGSGLNAVLE VEDSSEFSQS SLANVSCSQV KHVDAALGCH LQVNFCDERA DDSYSLGQEA  300
CYTNTNNVAS ALPETHHQLS ISENDLDKHL QQDFSEEMDL DIGYEHNTNA TSEADFDNKK  360
GLQSELWEDI SFQGILSAPD SISADSFLSP NCQRGLYSVE AAKNFEESLY PLHTFNSSSM  420
TSSAHLQSSA TSLPSSFISS GSASCTPGAK FETNGIPVSL ESITCQDVPS DMPIPESRKQ  480
QPTDVEQSSL EHTTMGREAS PIHGESVVGQ KKHSEALCYE PPCFPSVEVP FVSCDLLSSS  540
DLPEYSPLGI RELMRSSMNF STPIRLWSSP TRDMSSDAVL KSAAKSFICT PSIMKKRQRE  600
LSSPTPDIKF AKKIGAEKDC GNSGMSSTRT ERSFMDVIED ELLDFISHQN EENLKETTHQ  660
GINEENTKRN TLEEGKRCST MNKDTTCDAL STGILTESNA NSLSPPKDVK NPGIQKLNTT  720
AKSLSKEIIS SRSKPTNLVV EKSSPYINAD YQYVNILADT PGIKRGLESP SAWKSPLFTN  780
FQDGFFMSPA GRTFDALGLV KQINEQNAPA LEEAHEVLAC GRPQNPCSKE NSNKENIEQT  840
IIREHVTSNQ PSTVMAEARI LDYNECTTPV KKKEECSIFQ RSPTSSYLLK NVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-64502026158MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-64502026158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231586.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231587.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231588.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0Q3IM770.0A0A0Q3IM77_BRADI; Uncharacterized protein
STRINGBRADI2G31887.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-101Homeodomain-like protein